If you have been reading about incretin and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-06-28. Where a claim depends on a specific study, the study is described rather than over-claimed.
Solid peptide material is generally kept at reduced temperature to limit degradation. Short-term storage at 2 to 8 degrees Celsius is common, while longer archival storage at minus 20 degrees Celsius or below is typical for lyophilised powder. Vials should remain sealed and protected from light, because ultraviolet exposure can oxidise susceptible residues. Repeated freeze-thaw cycles are avoided, as they promote aggregation and loss of soluble material. Solutions are less stable than solids and are usually prepared close to the time of use.
Reversed-phase high-performance liquid chromatography is widely used to assess purity and to separate the parent peptide from related substances. Mass spectrometry confirms identity and can resolve modifications that differ by a few daltons. Size-exclusion chromatography detects dimers and higher aggregates, which are relevant to both stability and immunogenicity questions. Peptide mapping with enzymatic digestion locates specific modifications along the sequence. Circular dichroism provides a secondary-structure profile, although it gives limited information about local conformational changes.
Quality control for peptide material focuses on identity, purity, content and the profile of impurities. Common degradants include deamidated and oxidised forms, plus aggregates formed during storage or handling. Forced degradation studies under heat, light, acid and peroxide help define which conditions accelerate change and which analytical methods detect it. Limits for individual impurities are set by pharmacopoeial monographs or manufacturer specifications. How much a given impurity affects biological activity is often uncertain, and conclusions may depend on the assay used.
Semaglutide is a synthetic peptide analog of human glucagon-like peptide-1, developed by Novo Nordisk and first approved in 2017 for type 2 diabetes. It belongs to the incretin mimetic class, a group of agents that reproduce the glucose-dependent actions of endogenous GLP-1. The molecule was engineered to resist degradation by dipeptidyl peptidase-4 and to bind serum albumin, extending its half-life from minutes to roughly one week. Approval for chronic weight management followed in 2021, based on large cardiovascular and obesity outcome trials.
GLP-1 receptors are expressed on pancreatic beta cells, in the gut, and in several brain regions. Receptor activation raises cyclic AMP, enhances glucose-dependent insulin secretion, and suppresses glucagon release when blood glucose is high. Effects on gastric emptying and on hypothalamic appetite circuits reduce energy intake. Because insulin release remains glucose-dependent, the risk of hypoglycemia is low when the drug is used alone. The precise contribution of each pathway to body weight change in humans remains an area of active investigation.
Clinical studies of semaglutide generally measure glycated hemoglobin, fasting plasma glucose, body weight, and composite cardiovascular endpoints. The SUSTAIN program enrolled adults with type 2 diabetes, while the STEP program focused on obesity without diabetes. Administration follows a stepwise escalation schedule designed to limit gastrointestinal effects during the first weeks. Reported outcomes include mean percentage weight change, the proportion of participants reaching defined weight-loss thresholds, and rates of nausea, vomiting, and diarrhea. Long-term data on durability after treatment stops are still limited and remain a topic of ongoing research.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilised powder | Visual inspection under suitable light |
| Aqueous solubility | Soluble, pH dependent | Dissolves readily in neutral buffer |
| Storage temperature | 2-8 °C short term; -20 °C or below long term | Protect from light and moisture |
| Primary purity method | Reversed-phase HPLC | UV detection near 214 nm |
| Identity confirmation | LC-MS with peptide mapping | Mass accuracy within a few ppm |
Semaglutide is a synthetic peptide analog of human glucagon-like peptide-1, a gut hormone released after meals. Its backbone retains the GLP-1 sequence but incorporates two substitutions that slow enzymatic breakdown by dipeptidyl peptidase-4. A short polyethylene glycol linker and a C18 fatty diacid are attached to the peptide chain, allowing the molecule to bind serum albumin and remain in circulation far longer than the native hormone. The result is a circulating half-life measured in days rather than the minutes typical of endogenous GLP-1.
Receptor activation occurs at GLP-1 receptors distributed across pancreatic islets, the hypothalamus, and the gastrointestinal tract. Binding triggers G protein signaling that raises cyclic AMP and enhances glucose-dependent insulin release. Because the effect depends on prevailing glucose levels, insulin secretion does not rise when blood sugar is already low. Signaling in the brain and gut also influences appetite and gastric emptying, which is why the compound appears in both metabolic and weight-related research literature.
Routine characterisation of the peptide relies on reversed-phase high-performance liquid chromatography, often paired with ultraviolet detection near 214 nanometres. Related substances such as deamidated, oxidised, and truncated sequences elute at characteristic positions and are quantified by area percentage. Electrospray ionisation mass spectrometry confirms the molecular mass and can resolve some closely related variants. Peptide mapping after enzymatic digestion provides sequence-level verification and is useful when a full identity profile is required. Method parameters such as column chemistry, gradient, and mobile-phase pH influence the separation and must be reported alongside results.
Material described as research-grade is not necessarily manufactured to pharmaceutical standards, and purity figures depend on the method used to obtain them. A certificate of analysis states the measured purity, the analytical technique, and the batch identifier, but the underlying data are not always included. Independent testing by a second laboratory is a common way to confirm identity and purity. Uncertainties remain about how storage history affects long-term stability, and about how well results from one laboratory transfer to another. Documentation of handling conditions supports comparison between batches.
==== Mechanism of action ==== One of the components in nabiximol, tetrahydrocannabinol (THC), weakly stimulates cannabinoid receptor 1(CBR1) and cannabinoid receptor 2 (CBR2) to produce analgesic effect (pain relief). Another component of nabiximol, cannabidiol (CBD), slightly inhibits the proliferation of T cells (a type of immune cells) and the activity of microglia (cells within the brain that regulate neural activity and repair).
=== April === 3 April – Ted Hipkiss, cricketer (Northern Districts) (born 1947). 5 April Raymond Hawthorne, actor (Mortimer's Patch, Bread and Roses, Shortland Street) and theatre director (Mercury Theatre, National Opera of New Zealand) (born 1936). Di McCarthy, behavioural neuroscientist (University of Auckland), chief executive of the Royal Society of New Zealand Te Apārangi (2007–2014). 6 April Sue Berry, physiotherapist and businesswoman, co-founder of Whitestone Cheese (1987) (born 1944). Avis Fletcher, Olympic hurdler and sprinter (1964), British Empire and Commonwealth Games double bronze medallist (1962) (born 1938). 9 April Nancy Carr, home economist (University of Otago) (born 1936). John Mayhew, sports physician (All Blacks, North Harbour, New Zealand Warriors) (born 1954). 11 April – Robyn Kahukiwa, artist, children's writer and illustrator, Te Tohu mō Te Arikinui Dame Te Atairangikaahu (2020) (born 1938). 13 April John Bradshaw, geologist (University of Canterbury), Fellow of the Royal Society of New Zealand (since 1999) (born 1939). David Kernohan, architect and academic (Victoria University of Wellington) (born 1947). 14 April – Peter Matheson, theologian (University of Otago) (born 1938). 16 April – Roger McLachlan, rock bassist (Little River Band) (born 1954). 18 April – Bill Woods, local politician and community leader, Mayor of Selwyn (1992–1995) (born 1942). 19 April – Peter Hilt, politician, MP for Glenfield (1990–1996) (born 1942).
It includes the midbrain, pons, and medulla oblongata and regulates essential functions such as breathing, heart rate, and sleep. Brain ventricles A set of interconnected cavities within the brain that produce and circulate cerebrospinal fluid (CSF). Includes the lateral, third, and fourth ventricles. Brain waves Patterns of electrical activity in the brain, typically detected by electroencephalography (EEG). Brain waves are categorized by frequency, such as alpha, beta, delta, and theta waves. Brain-computer interface (BCI) A technology that enables direct communication between the brain and an external device, often used in research, prosthetics, and communication aids for individuals with disabilities. Bradykinesia Slowness of movement, often a symptom of Parkinson’s disease and other disorders involving the basal ganglia. Broca's area A region in the frontal lobe, typically in the left hemisphere, associated with the production of speech. Damage can result in Broca's aphasia, characterized by impaired speech fluency. Broca's aphasia A language disorder caused by damage to Broca's area, resulting in slow, laborious speech with relatively preserved comprehension. Brodmann areas Regions of the cerebral cortex defined by Korbinian Brodmann based on cytoarchitecture. These areas are still widely used to describe functional brain localization (e.g., Brodmann area 17 = primary visual cortex). Burst firing A pattern of rapid spikes from a neuron followed by a period of quiescence. It plays a role in sensory encoding and signal amplification in various brain circuits.
Sources: en.wikipedia.org
The high percentage of alcohol in absinthe would result in mortality long before thujone could become a factor. In documented cases of acute thujone poisoning as a result of oral ingestion, the source of thujone was not commercial absinthe, but rather non-absinthe-related sources, such as common essential oils (which may contain as much as 50% thujone). One study published in the Journal of Studies on Alcohol concluded that high doses (0.28 mg/kg) of thujone in alcohol had negative effects on attention performance in a clinical setting. It delayed reaction time, and caused subjects to concentrate their attention on the central field of vision. Low doses (0.028 mg/kg) did not produce an effect noticeably different from the plain alcohol control. While the effects of the high dose samples were statistically significant in a double blind test, the test subjects themselves were unable to reliably identify which samples contained thujone. For the average 65 kg (143 lb) man, the high dose samples in the study would equate to 18.2 mg of thujone. The EU limit of 35 mg/L of thujone in absinthe means that given the highest permitted thujone content, that individual would need to consume approximately 0.5 litres of high-proof (e.g. 50%+ ABV) spirit before the thujone could be metabolized to display effects detectable in a clinical setting, which would result in a potentially lethal BAC of >0.4%.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Swiss chemist Albert Hofmann first synthesized LSD in 1938 and discovered its potent psychedelic effects in 1943 after accidental ingestion. It became widely studied in the 1950s and 1960s. The drug was initially explored for psychiatric use due to its structural similarity to serotonin and safety profile. It was used experimentally in psychiatry for treating alcoholism and schizophrenia. By the mid-1960s, LSD became central to the youth counterculture in places like San Francisco and London, influencing art, music, and social movements through events like Acid Tests and figures such as Timothy Leary, Owsley Stanley and Michael Hollingshead. Its psychedelic effects inspired distinct visual art styles and musical innovations, and caused a lasting cultural impact. However, its association with the counterculture movement of the 1960s led to its classification as a Schedule I drug in the United States in 1970. It was also listed as a Schedule I controlled substance by the United Nations in 1971 and remains without approved medical uses. Despite its legal restrictions, LSD remains influential in scientific and cultural contexts. Research on LSD declined due to cultural controversies by the 1960s, but has resurged since 2009. In 2024, the United States Food and Drug Administration designated LSD (code name MM120 or DT120) as a breakthrough therapy for generalized anxiety disorder. As of 2017, about 10% of people in the United States had used LSD at some point, with 0.7% having used it in the past year.
Sources: en.wikipedia.org
Lower temperatures slow hydrolysis, oxidation and aggregation reactions that degrade the molecule over time. Lyophilised powder is more tolerant than solution, but both benefit from controlled conditions.
Mass spectrometry and peptide mapping are commonly used, often alongside chromatographic retention time comparison. No single technique covers both sequence and higher-order structure.
Aggregation is monitored because it can alter activity and may influence immune responses. Size-exclusion chromatography and related techniques are used to quantify it.
It is given either as a once-weekly subcutaneous injection or as an oral tablet taken once daily. The two forms use different absorption strategies, so they are not interchangeable on a milligram-for-milligram basis.